PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0096s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 334aa    MW: 38086.2 Da    PI: 4.7329
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0096s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.42.8e-26958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtfskRrng++KKA+ELS+LCd+++a+++fs++++l  +s
  Cagra.0096s0037.1.p  9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALLMFSPSDRLSLFS 58
                         79******************************************998776 PP

2K-box19.93e-08121190978
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqie 78 
                          + +++ e+l++e+ kL++++++ ++e+R++  + +   ++++ +  e+qL + l+++ ++++++l +  +
  Cagra.0096s0037.1.p 121 AINSDVEELEHEVYKLQQQLHMAEEELRKYEPDPIRFTTMEDYETCEKQLTDTLTRVGQRREHILNDLSS 190
                          5567899******************************************************999877554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.805161IPR002100Transcription factor, MADS-box
CDDcd002658.00E-35275No hitNo description
SuperFamilySSF554559.94E-29280IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-24323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALLMFSP SDRLSLFSGK  60
TRIEDVFSRY INLSDQERES ALVFPDQSRR PDFQSKEYLL RTLQQLKNEN DIALQLTNPA  120
AINSDVEELE HEVYKLQQQL HMAEEELRKY EPDPIRFTTM EDYETCEKQL TDTLTRVGQR  180
REHILNDLSS SYEASAIQQQ QNMGGPFVND VVGGWLTENG PNQAHLFDAS AHSAMYETLL  240
QGSSSSSNQN NIMGESNVSN HNGDNMFQEW AQAYNSTTAH NPPNLFPPMQ QQHQHGLVGS  300
NVEEIEVPVM KKEAQADHEV SDYDTRMPQL SSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-15270168Myocyte-specific enhancer factor 2A
3mu6_C1e-15270168Myocyte-specific enhancer factor 2A
3mu6_B1e-15270168Myocyte-specific enhancer factor 2A
3mu6_A1e-15270168Myocyte-specific enhancer factor 2A
1tqe_S1e-15190191Myocyte-specific enhancer factor 2B
1tqe_R1e-15190191Myocyte-specific enhancer factor 2B
1tqe_Q1e-15190191Myocyte-specific enhancer factor 2B
1tqe_P1e-15190191Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464410.0DQ446441.1 Arabidopsis thaliana clone pENTR221-At1g77980 MADS-box family protein (At1g77980) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301191.10.0hypothetical protein CARUB_v10021590mg
SwissprotQ1PFC20.0AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLR0HW850.0R0HW85_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__2091__AT1G77980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.10.0AGAMOUS-like 66